kdelibs/kdecore/date/kcalendarsystemislamiccivil.cpp
Ivailo Monev 2cf411e2ed kdecore: remove unused and deprecated KLocale/KCalendarSystem setters and getters
Signed-off-by: Ivailo Monev <xakepa10@gmail.com>
2023-07-23 08:04:44 +03:00

591 lines
22 KiB
C++

/*
Copyright (c) 2002-2003 Carlos Moro <cfmoro@correo.uniovi.es>
Copyright (c) 2002-2003 Hans Petter Bieker <bieker@kde.org>
Copyright 2007, 2008, 2009, 2010 John Layt <john@layt.net>
This library is free software; you can redistribute it and/or
modify it under the terms of the GNU Library General Public
License as published by the Free Software Foundation; either
version 2 of the License, or (at your option) any later version.
This library is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
Library General Public License for more details.
You should have received a copy of the GNU Library General Public License
along with this library; see the file COPYING.LIB. If not, write to
the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor,
Boston, MA 02110-1301, USA.
*/
#include "kcalendarsystemislamiccivil_p.h"
#include "kcalendarsystemprivate_p.h"
#include <QtCore/qdatetime.h>
class KCalendarSystemIslamicCivilPrivate : public KCalendarSystemPrivate
{
public:
explicit KCalendarSystemIslamicCivilPrivate(KCalendarSystemIslamicCivil *q);
virtual ~KCalendarSystemIslamicCivilPrivate();
// Virtual methods each calendar system must re-implement
virtual KLocale::CalendarSystem calendarSystem() const;
virtual void loadDefaultEraList();
virtual int monthsInYear(int year) const;
virtual int daysInMonth(int year, int month) const;
virtual int daysInYear(int year) const;
virtual int daysInWeek() const;
virtual bool isLeapYear(int year) const;
virtual bool hasLeapMonths() const;
virtual bool hasYearZero() const;
virtual int maxDaysInWeek() const;
virtual int maxMonthsInYear() const;
virtual int earliestValidYear() const;
virtual int latestValidYear() const;
virtual QString monthName(int month, int year, KLocale::DateTimeComponentFormat format, bool possessive) const;
virtual QString weekDayName(int weekDay, KLocale::DateTimeComponentFormat format) const;
};
// Shared d pointer base class definitions
KCalendarSystemIslamicCivilPrivate::KCalendarSystemIslamicCivilPrivate(KCalendarSystemIslamicCivil *q)
: KCalendarSystemPrivate(q)
{
}
KCalendarSystemIslamicCivilPrivate::~KCalendarSystemIslamicCivilPrivate()
{
}
KLocale::CalendarSystem KCalendarSystemIslamicCivilPrivate::calendarSystem() const
{
return KLocale::IslamicCivilCalendar;
}
void KCalendarSystemIslamicCivilPrivate::loadDefaultEraList()
{
QString name, shortName, format;
// Islamic Era, Anno Hegirae, "Year of the Hijra".
name = i18nc("Calendar Era: Hijri Islamic Era, years > 0, LongFormat", "Anno Hegirae");
shortName = i18nc("Calendar Era: Hijri Islamic Era, years > 0, ShortFormat", "AH");
format = i18nc("(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH", "%Ey %EC");
addEra('+', 1, q->epoch(), 1, q->latestValidDate(), name, shortName, format);
}
int KCalendarSystemIslamicCivilPrivate::monthsInYear(int year) const
{
Q_UNUSED(year)
return 12;
}
int KCalendarSystemIslamicCivilPrivate::daysInMonth(int year, int month) const
{
if (month == 12 && isLeapYear(year)) {
return 30;
}
if (month % 2 == 0) { // Even number months have 29 days
return 29;
} else { // Odd number months have 30 days
return 30;
}
}
int KCalendarSystemIslamicCivilPrivate::daysInYear(int year) const
{
if (isLeapYear(year)) {
return 355;
} else {
return 354;
}
}
int KCalendarSystemIslamicCivilPrivate::daysInWeek() const
{
return 7;
}
bool KCalendarSystemIslamicCivilPrivate::isLeapYear(int year) const
{
// Years 2, 5, 7, 10, 13, 16, 18, 21, 24, 26, 29 of the 30 year cycle
/*
The following C++ code is translated from the Lisp code
in ``Calendrical Calculations'' by Nachum Dershowitz and
Edward M. Reingold, Software---Practice & Experience,
vol. 20, no. 9 (September, 1990), pp. 899--928.
This code is in the public domain, but any use of it
should publically acknowledge its source.
*/
if ((((11 * year) + 14) % 30) < 11) {
return true;
} else {
return false;
}
// The following variations will be implemented in separate classes in 4.5
// May be cleaner to formally define using a case statement switch on (year % 30)
// Variation used by Bar Habraeus / Graves / Birashk / Some Microsoft products
// Years 2, 5, 7, 10, 13, 15, 18, 21, 24, 26, 29 of the 30 year cycle
// if ( ( ( ( 11 * year ) + 15 ) % 30 ) < 11 ) {
// Variation used by Bohras / Sahifa with epoch 15 July 622 jd = 1948440
// Years 2, 5, 8, 10, 13, 16, 19, 21, 24, 27, 29 of the 30 year cycle
// if ( ( ( ( 11 * year ) + 1 ) % 30 ) < 11 ) {
}
bool KCalendarSystemIslamicCivilPrivate::hasLeapMonths() const
{
return false;
}
bool KCalendarSystemIslamicCivilPrivate::hasYearZero() const
{
return false;
}
int KCalendarSystemIslamicCivilPrivate::maxDaysInWeek() const
{
return 7;
}
int KCalendarSystemIslamicCivilPrivate::maxMonthsInYear() const
{
return 12;
}
int KCalendarSystemIslamicCivilPrivate::earliestValidYear() const
{
return 1;
}
int KCalendarSystemIslamicCivilPrivate::latestValidYear() const
{
return 9999;
}
QString KCalendarSystemIslamicCivilPrivate::monthName(int month, int year, KLocale::DateTimeComponentFormat format, bool possessive) const
{
Q_UNUSED(year);
if (format == KLocale::NarrowName) {
switch (month) {
case 1:
return ki18nc("Hijri month 1 - KLocale::NarrowName", "M").toString(locale());
case 2:
return ki18nc("Hijri month 2 - KLocale::NarrowName", "S").toString(locale());
case 3:
return ki18nc("Hijri month 3 - KLocale::NarrowName", "A").toString(locale());
case 4:
return ki18nc("Hijri month 4 - KLocale::NarrowName", "T").toString(locale());
case 5:
return ki18nc("Hijri month 5 - KLocale::NarrowName", "A").toString(locale());
case 6:
return ki18nc("Hijri month 6 - KLocale::NarrowName", "T").toString(locale());
case 7:
return ki18nc("Hijri month 7 - KLocale::NarrowName", "R").toString(locale());
case 8:
return ki18nc("Hijri month 8 - KLocale::NarrowName", "S").toString(locale());
case 9:
return ki18nc("Hijri month 9 - KLocale::NarrowName", "R").toString(locale());
case 10:
return ki18nc("Hijri month 10 - KLocale::NarrowName", "S").toString(locale());
case 11:
return ki18nc("Hijri month 11 - KLocale::NarrowName", "Q").toString(locale());
case 12:
return ki18nc("Hijri month 12 - KLocale::NarrowName", "H").toString(locale());
default:
return QString();
}
}
if (format == KLocale::ShortName && possessive) {
switch (month) {
case 1:
return ki18nc("Hijri month 1 - KLocale::ShortName Possessive", "of Muh").toString(locale());
case 2:
return ki18nc("Hijri month 2 - KLocale::ShortName Possessive", "of Saf").toString(locale());
case 3:
return ki18nc("Hijri month 3 - KLocale::ShortName Possessive", "of R.A").toString(locale());
case 4:
return ki18nc("Hijri month 4 - KLocale::ShortName Possessive", "of R.T").toString(locale());
case 5:
return ki18nc("Hijri month 5 - KLocale::ShortName Possessive", "of J.A").toString(locale());
case 6:
return ki18nc("Hijri month 6 - KLocale::ShortName Possessive", "of J.T").toString(locale());
case 7:
return ki18nc("Hijri month 7 - KLocale::ShortName Possessive", "of Raj").toString(locale());
case 8:
return ki18nc("Hijri month 8 - KLocale::ShortName Possessive", "of Sha").toString(locale());
case 9:
return ki18nc("Hijri month 9 - KLocale::ShortName Possessive", "of Ram").toString(locale());
case 10:
return ki18nc("Hijri month 10 - KLocale::ShortName Possessive", "of Shw").toString(locale());
case 11:
return ki18nc("Hijri month 11 - KLocale::ShortName Possessive", "of Qid").toString(locale());
case 12:
return ki18nc("Hijri month 12 - KLocale::ShortName Possessive", "of Hij").toString(locale());
default:
return QString();
}
}
if (format == KLocale::ShortName && !possessive) {
switch (month) {
case 1:
return ki18nc("Hijri month 1 - KLocale::ShortName", "Muh").toString(locale());
case 2:
return ki18nc("Hijri month 2 - KLocale::ShortName", "Saf").toString(locale());
case 3:
return ki18nc("Hijri month 3 - KLocale::ShortName", "R.A").toString(locale());
case 4:
return ki18nc("Hijri month 4 - KLocale::ShortName", "R.T").toString(locale());
case 5:
return ki18nc("Hijri month 5 - KLocale::ShortName", "J.A").toString(locale());
case 6:
return ki18nc("Hijri month 6 - KLocale::ShortName", "J.T").toString(locale());
case 7:
return ki18nc("Hijri month 7 - KLocale::ShortName", "Raj").toString(locale());
case 8:
return ki18nc("Hijri month 8 - KLocale::ShortName", "Sha").toString(locale());
case 9:
return ki18nc("Hijri month 9 - KLocale::ShortName", "Ram").toString(locale());
case 10:
return ki18nc("Hijri month 10 - KLocale::ShortName", "Shw").toString(locale());
case 11:
return ki18nc("Hijri month 11 - KLocale::ShortName", "Qid").toString(locale());
case 12:
return ki18nc("Hijri month 12 - KLocale::ShortName", "Hij").toString(locale());
default:
return QString();
}
}
if (format == KLocale::LongName && possessive) {
switch (month) {
case 1:
return ki18nc("Hijri month 1 - KLocale::LongName Possessive", "of Muharram").toString(locale());
case 2:
return ki18nc("Hijri month 2 - KLocale::LongName Possessive", "of Safar").toString(locale());
case 3:
return ki18nc("Hijri month 3 - KLocale::LongName Possessive", "of Rabi` al-Awal").toString(locale());
case 4:
return ki18nc("Hijri month 4 - KLocale::LongName Possessive", "of Rabi` al-Thaani").toString(locale());
case 5:
return ki18nc("Hijri month 5 - KLocale::LongName Possessive", "of Jumaada al-Awal").toString(locale());
case 6:
return ki18nc("Hijri month 6 - KLocale::LongName Possessive", "of Jumaada al-Thaani").toString(locale());
case 7:
return ki18nc("Hijri month 7 - KLocale::LongName Possessive", "of Rajab").toString(locale());
case 8:
return ki18nc("Hijri month 8 - KLocale::LongName Possessive", "of Sha`ban").toString(locale());
case 9:
return ki18nc("Hijri month 9 - KLocale::LongName Possessive", "of Ramadan").toString(locale());
case 10:
return ki18nc("Hijri month 10 - KLocale::LongName Possessive", "of Shawwal").toString(locale());
case 11:
return ki18nc("Hijri month 11 - KLocale::LongName Possessive", "of Thu al-Qi`dah").toString(locale());
case 12:
return ki18nc("Hijri month 12 - KLocale::LongName Possessive", "of Thu al-Hijjah").toString(locale());
default:
return QString();
}
}
// Default to LongName
switch (month) {
case 1:
return ki18nc("Hijri month 1 - KLocale::LongName", "Muharram").toString(locale());
case 2:
return ki18nc("Hijri month 2 - KLocale::LongName", "Safar").toString(locale());
case 3:
return ki18nc("Hijri month 3 - KLocale::LongName", "Rabi` al-Awal").toString(locale());
case 4:
return ki18nc("Hijri month 4 - KLocale::LongName", "Rabi` al-Thaani").toString(locale());
case 5:
return ki18nc("Hijri month 5 - KLocale::LongName", "Jumaada al-Awal").toString(locale());
case 6:
return ki18nc("Hijri month 6 - KLocale::LongName", "Jumaada al-Thaani").toString(locale());
case 7:
return ki18nc("Hijri month 7 - KLocale::LongName", "Rajab").toString(locale());
case 8:
return ki18nc("Hijri month 8 - KLocale::LongName", "Sha`ban").toString(locale());
case 9:
return ki18nc("Hijri month 9 - KLocale::LongName", "Ramadan").toString(locale());
case 10:
return ki18nc("Hijri month 10 - KLocale::LongName", "Shawwal").toString(locale());
case 11:
return ki18nc("Hijri month 11 - KLocale::LongName", "Thu al-Qi`dah").toString(locale());
case 12:
return ki18nc("Hijri month 12 - KLocale::LongName", "Thu al-Hijjah").toString(locale());
default:
return QString();
}
}
QString KCalendarSystemIslamicCivilPrivate::weekDayName(int weekDay, KLocale::DateTimeComponentFormat format) const
{
if (format == KLocale::NarrowName) {
switch (weekDay) {
case 1:
return ki18nc("Hijri weekday 1 - KLocale::NarrowName ", "I").toString(locale());
case 2:
return ki18nc("Hijri weekday 2 - KLocale::NarrowName ", "T").toString(locale());
case 3:
return ki18nc("Hijri weekday 3 - KLocale::NarrowName ", "A").toString(locale());
case 4:
return ki18nc("Hijri weekday 4 - KLocale::NarrowName ", "K").toString(locale());
case 5:
return ki18nc("Hijri weekday 5 - KLocale::NarrowName ", "J").toString(locale());
case 6:
return ki18nc("Hijri weekday 6 - KLocale::NarrowName ", "S").toString(locale());
case 7:
return ki18nc("Hijri weekday 7 - KLocale::NarrowName ", "A").toString(locale());
default:
return QString();
}
}
if (format == KLocale::ShortName || format == KLocale:: ShortNumber) {
switch (weekDay) {
case 1:
return ki18nc("Hijri weekday 1 - KLocale::ShortName", "Ith").toString(locale());
case 2:
return ki18nc("Hijri weekday 2 - KLocale::ShortName", "Thl").toString(locale());
case 3:
return ki18nc("Hijri weekday 3 - KLocale::ShortName", "Arb").toString(locale());
case 4:
return ki18nc("Hijri weekday 4 - KLocale::ShortName", "Kha").toString(locale());
case 5:
return ki18nc("Hijri weekday 5 - KLocale::ShortName", "Jum").toString(locale());
case 6:
return ki18nc("Hijri weekday 6 - KLocale::ShortName", "Sab").toString(locale());
case 7:
return ki18nc("Hijri weekday 7 - KLocale::ShortName", "Ahd").toString(locale());
default: return QString();
}
}
switch (weekDay) {
case 1:
return ki18nc("Hijri weekday 1 - KLocale::LongName", "Yaum al-Ithnain").toString(locale());
case 2:
return ki18nc("Hijri weekday 2 - KLocale::LongName", "Yau al-Thulatha").toString(locale());
case 3:
return ki18nc("Hijri weekday 3 - KLocale::LongName", "Yaum al-Arbi'a").toString(locale());
case 4:
return ki18nc("Hijri weekday 4 - KLocale::LongName", "Yaum al-Khamees").toString(locale());
case 5:
return ki18nc("Hijri weekday 5 - KLocale::LongName", "Yaum al-Jumma").toString(locale());
case 6:
return ki18nc("Hijri weekday 6 - KLocale::LongName", "Yaum al-Sabt").toString(locale());
case 7:
return ki18nc("Hijri weekday 7 - KLocale::LongName", "Yaum al-Ahad").toString(locale());
default:
return QString();
}
}
KCalendarSystemIslamicCivil::KCalendarSystemIslamicCivil(const KLocale *locale)
: KCalendarSystem(*new KCalendarSystemIslamicCivilPrivate(this), KSharedConfig::Ptr(), locale)
{
d_ptr->loadConfig(calendarType());
}
KCalendarSystemIslamicCivil::KCalendarSystemIslamicCivil(const KSharedConfig::Ptr config, const KLocale *locale)
: KCalendarSystem(*new KCalendarSystemIslamicCivilPrivate(this), config, locale)
{
d_ptr->loadConfig(calendarType());
}
KCalendarSystemIslamicCivil::KCalendarSystemIslamicCivil(KCalendarSystemIslamicCivilPrivate &dd,
const KSharedConfig::Ptr config, const KLocale *locale)
: KCalendarSystem(dd, config, locale)
{
d_ptr->loadConfig(calendarType());
}
KCalendarSystemIslamicCivil::~KCalendarSystemIslamicCivil()
{
}
QString KCalendarSystemIslamicCivil::calendarType() const
{
return QLatin1String("hijri");
}
QDate KCalendarSystemIslamicCivil::epoch() const
{
// 16 July 622 in the Julian calendar
return QDate::fromJulianDay(1948440);
}
QDate KCalendarSystemIslamicCivil::earliestValidDate() const
{
return epoch();
}
QDate KCalendarSystemIslamicCivil::latestValidDate() const
{
// Set to last day of year 9999
// Last day of Islamic Civil year 9999 is 9999-12-29
return QDate::fromJulianDay(5491751);
}
bool KCalendarSystemIslamicCivil::isValid(int year, int month, int day) const
{
return KCalendarSystem::isValid(year, month, day);
}
bool KCalendarSystemIslamicCivil::isValid(const QDate &date) const
{
return KCalendarSystem::isValid(date);
}
bool KCalendarSystemIslamicCivil::isLeapYear(int year) const
{
return KCalendarSystem::isLeapYear(year);
}
bool KCalendarSystemIslamicCivil::isLeapYear(const QDate &date) const
{
return KCalendarSystem::isLeapYear(date);
}
QString KCalendarSystemIslamicCivil::monthName(int month, int year, MonthNameFormat format) const
{
return KCalendarSystem::monthName(month, year, format);
}
QString KCalendarSystemIslamicCivil::monthName(const QDate &date, MonthNameFormat format) const
{
return KCalendarSystem::monthName(date, format);
}
QString KCalendarSystemIslamicCivil::weekDayName(int weekDay, WeekDayNameFormat format) const
{
return KCalendarSystem::weekDayName(weekDay, format);
}
QString KCalendarSystemIslamicCivil::weekDayName(const QDate &date, WeekDayNameFormat format) const
{
return KCalendarSystem::weekDayName(date, format);
}
bool KCalendarSystemIslamicCivil::isLunar() const
{
return true;
}
bool KCalendarSystemIslamicCivil::isLunisolar() const
{
return false;
}
bool KCalendarSystemIslamicCivil::isSolar() const
{
return false;
}
bool KCalendarSystemIslamicCivil::isProleptic() const
{
return false;
}
bool KCalendarSystemIslamicCivil::julianDayToDate(int jd, int &year, int &month, int &day) const
{
Q_D(const KCalendarSystemIslamicCivil);
/*
The following C++ code is translated from the Lisp code
in ``Calendrical Calculations'' by Nachum Dershowitz and
Edward M. Reingold, Software---Practice & Experience,
vol. 20, no. 9 (September, 1990), pp. 899--928.
This code is in the public domain, but any use of it
should publically acknowledge its source.
*/
// Search forward year by year from approximate year
year = (jd - epoch().toJulianDay()) / 355;
int testJd;
dateToJulianDay(year, 12, d->daysInMonth(year, 12), testJd);
while (jd > testJd) {
year++;
dateToJulianDay(year, 12, d->daysInMonth(year, 12), testJd);
}
// Search forward month by month from Muharram
month = 1;
dateToJulianDay(year, month, d->daysInMonth(year, month), testJd);
while (jd > testJd) {
month++;
dateToJulianDay(year, month, d->daysInMonth(year, month), testJd);
}
dateToJulianDay(year, month, 1, testJd);
day = jd - testJd + 1;
return true;
// Alternative implementations
// More recent editions of "Calendrical Calculations" by Dershowitz & Reingold have a more
// efficient direct calculation without recusrion, but this cannot be used due to licensing
/*
Formula from "Explanatory Supplement to the Astronomical Almanac" 2006, derived from Fliegel & Van Flandern 1968
int L = jd - epoch().toJulianDay() + 10632;
int N = ( L - 1 ) / 10631;
L = L - 10631 * N + 354;
int J = ( ( 10985 - L ) / 5316 ) x ( ( 50* L ) / 17719 ) + ( L / 5670 ) * ( ( 43 * L ) / 15238 );
L = L - ( ( 30 - J ) / 15 ) * ( ( 17719 * J ) / 50 ) - ( J / 16 ) * ( ( 15238 * J ) / 43 ) + 29;
year = ( 30 * N ) + J - 30;
month = ( 24 * L ) / 709;
day = L - ( ( 709 * month ) / 24 );
*/
/*
Formula from Fourmilab website
jd = Math.floor(jd) + 0.5;
year = Math.floor(((30 * (jd - epoch().toJulianDay())) + 10646) / 10631);
month = qMin(12, Math.ceil((jd - (29 + islamic_to_jd(year, 1, 1))) / 29.5) + 1);
day = (jd - islamic_to_jd(year, month, 1)) + 1;
*/
}
bool KCalendarSystemIslamicCivil::dateToJulianDay(int year, int month, int day, int &jd) const
{
/*
The following C++ code is translated from the Lisp code
in ``Calendrical Calculations'' by Nachum Dershowitz and
Edward M. Reingold, Software---Practice & Experience,
vol. 20, no. 9 (September, 1990), pp. 899--928.
This code is in the public domain, but any use of it
should publically acknowledge its source.
*/
jd = epoch().toJulianDay() - 1 + // days before start of calendar
(year - 1) * 354 + // non-leap days in prior years
(3 + (11 * year)) / 30 + // leap days in prior years
29 * (month - 1) + // days so far...
month / 2 + // ...this year
day; // days so far this month
return true;
// Alternative implementations
/*
Formula from "Explanatory Supplement to the Astronomical Almanac" 2006, derived from Fliegel & Van Flandern 1968
jd = ( 3 + ( 11 * year ) ) / 30 + 354 * year + 30 * month - ( month - 1 ) / 2 + day + epoch().toJulianDay() - 385;
*/
}